SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003188 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003188
Domain Number 1 Region: 329-596
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-56
Family Kelch motif 0.0003
Further Details:      
 
Domain Number 2 Region: 18-127
Classification Level Classification E-value
Superfamily POZ domain 1.33e-29
Family BTB/POZ domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003188   Gene: ENSPANG00000009491   Transcript: ENSPANT00000019871
Sequence length 621
Comment pep:known_by_projection chromosome:PapAnu2.0:2:92781714:92788019:-1 gene:ENSPANG00000009491 transcript:ENSPANT00000019871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRAGEREFPCHRLVLAACSPYFRA
RFLAEPERAGELHLEEVSPDVVAQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTIC
VSFLQKRLCLSNCLAVFRLGLLLDCARLAVAARDFICAHFSLVARDADFLGLSADELIAI
ISSDGLNVEKEEAVFEAVMRWAGSGDAEAQAERQRALPTVFESVRCRLLPRAFLESRVER
HPLVRAQPELLRKVQMVKDAHEGRITTLRKKKKGKDAAGVKEADKGTGEAKAEEDEEAER
ILPGILNDTLRFGMFLQDLIFMISEEGAVAYDPAANECYCASLSNQVPKNHVSLVTKENQ
VFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVVGGR
EIKDGERCLDSVMCYDRLSFKWGESDPLPYAVYGHTVLSHMDLVYVIGGKGSDRKCLNKM
CVYDPKKFEWKELAPMQTARSLFGATVHDGRIIVAAGVTDTGLTSSAEVYSITDNKWAPF
EAFPQERSSLSLVSLVGTLYAIGGFATLETESGELVPTELNDIWRYNEEEKKWEGVLREI
AYAAGATFLPVRLNVLRLTKM
Download sequence
Identical sequences A0A096MTP7 A0A2K5KJV0 A0A2K5WTG3 A0A2K5XDK6 G7MIX9
XP_005546840.1.63531 XP_011839658.1.47321 XP_011889496.1.92194 ENSPANP00000003188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]