SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003351 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003351
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000204
Family DNA polymerase processivity factor 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003351   Gene: ENSPANG00000009981   Transcript: ENSPANT00000019075
Sequence length 280
Comment pep:known_by_projection chromosome:PapAnu2.0:3:63350119:63364801:1 gene:ENSPANG00000009981 transcript:ENSPANT00000019075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
ENFFNEYQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
SMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHQDRNMEHMAEVHIDIRKLLQF
LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
Download sequence
Identical sequences A0A096MU54 A0A2K5MAX3
ENSPANP00000003351 XP_011920889.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]