SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003634 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003634
Domain Number 1 Region: 12-313
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.58e-69
Family Leucine carboxy methyltransferase Ppm1 0.0038
Further Details:      
 
Domain Number 2 Region: 479-668
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-21
Family Kelch motif 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000003634
Domain Number - Region: 352-435
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000248
Family Galactose oxidase, central domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003634   Gene: ENSPANG00000018954   Transcript: ENSPANT00000002998
Sequence length 686
Comment pep:known_by_projection chromosome:PapAnu2.0:7:17899891:17901948:-1 gene:ENSPANG00000018954 transcript:ENSPANT00000002998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRNRERRAGAVQSTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYIRA
RAVRHCVRAFLEQTGALHAARRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPNVAR
RKAERIGETPELCALTGPFQRGEPASALCFESADYCILGLDLRQLQRVDEALGAAGLDAA
SPTLLLAEAVLTYLETESAAALIAWAAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNS
PLHGLERFPDVEAQRRRFLQAGWTACGAVDMNEFYRCFLPAEERRRVENIEPFDEFEEWH
LKCAHYFILAASRGDILSHTLVFPSSEAFPRLNPASPSGVFPASVVSSEGQVPNLKRYGH
ASVLLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDGDSEWKGSQIGDCGTGVHWDGRLYH
TMTRLSESRVLVLGGRLSPVSPALGVLQLHFCNSEDNNTQDLKVTITKAGPKNDSTLSCW
RHSTTEVSYQNQEYLFVYGGRSVVEPVLSDWHFLHVETMAWVRIPVEGEVPEARHSHSAC
TWQGGALIAGGLGASEEPLNSVLFLRPTSCGFLWESIDIQPPITPRYSHTAHVLNGKLLL
VGGVWIHSSSFPGVTVINLTTGLSSEYAIDTTYVPWPLMLHNHTSILLPEEQQLLLLGGG
GNCFSFGTYFNTHTVTLDLSSLSAGQ
Download sequence
Identical sequences ENSPANP00000003634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]