SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003814 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003814
Domain Number 1 Region: 356-456
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00088
Further Details:      
 
Domain Number 2 Region: 94-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.29e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 
Domain Number 3 Region: 177-231,259-273
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000182
Family BphP N-terminal domain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003814   Gene: ENSPANG00000004474   Transcript: ENSPANT00000021662
Sequence length 622
Comment pep:known_by_projection chromosome:PapAnu2.0:11:26774223:26843167:1 gene:ENSPANG00000004474 transcript:ENSPANT00000021662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAAGGKVLREENQRTAPVVSSRVSPRTGPTAMGSFSSHMTEFPQKRKASDSDPS
QSGIMTEKVVEKISENPLTYLLSTRIEISASSGSREAHSQTEKRRRDKMNNLIEELSAMI
PQCNPMARKLDKLTVLRMAVQHLRSLKGMTNSYVGNNCRPSFIQDNELRHLILKTAEGFL
FVVGCERGKILFVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKL
IDAKTGLQVHSNFHTGRTHVYSGSRRSFFCRIKSCKISVKEEHECLPNPKKKEHRKFYTI
HCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVAIGRLQPYIIPQNSGEIHVKPTEFITR
FAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLTDKHKAVLQSKEKILTDS
YKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFFPCNSQSSEES
SRQSCMSVPGMSAGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTDLMKDTNTVNCR
NMSNKELFPPSPSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDTLCDNDDTAMAAFM
NYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences A0A096MVD9
ENSPANP00000003814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]