SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004059 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004059
Domain Number 1 Region: 11-277
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.53e-77
Family Inorganic pyrophosphatase 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004059   Gene: ENSPANG00000011540   Transcript: ENSPANT00000019904
Sequence length 281
Comment pep:novel chromosome:PapAnu2.0:2:158247085:158247955:-1 gene:ENSPANG00000011540 transcript:ENSPANT00000019904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGLSTEVHTVPFSLEYRVFFKNEKGQYVFPFHDIPIYADKDVFHMVEVPRWSNAKMEIA
TKPLNTIKQDLRYVVNLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPTDVCETGS
KCARGEIIDGKALGILAMIDKRETDWKVIATLTVDDPYAANYSDINDVKRLKPGYLEATL
DWVRRYKFPDGKPNEFAFKAAFKDKDFTTDIIKSTHDHWKALVTKKINGKGISCMNTTVS
ESPFKCDPDAARAIVDALPPSCESACTVPTDVDKWFHHQKN
Download sequence
Identical sequences ENSPANP00000004059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]