SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004060 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004060
Domain Number 1 Region: 323-617
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-77
Family Kelch motif 0.0000844
Further Details:      
 
Domain Number 2 Region: 8-62,118-182
Classification Level Classification E-value
Superfamily POZ domain 1.49e-28
Family BTB/POZ domain 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000004060
Domain Number - Region: 79-104
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004060   Gene: ENSPANG00000013400   Transcript: ENSPANT00000012680
Sequence length 629
Comment pep:known_by_projection chromosome:PapAnu2.0:18:24646946:24747394:-1 gene:ENSPANG00000013400 transcript:ENSPANT00000012680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLGGGVGGQDGLGAPKDQQQPPQQQQPSQQQQPPPQEEPGTPSSSPDDKLLTSP
RAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLND
QISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELALF
QMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAMN
YHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIMP
YNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFYA
CRLDKHLYVIGGRNETGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGGV
HNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVMLV
ECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGTW
TELEGDVAEPLAGPACVTVILPSCVPYNK
Download sequence
Identical sequences A0A096MW19 A0A0D9RZ61 A0A2K5KHE5 A0A2K5PD81 A0A2K5VDI5 A0A2K6DH29 A0A2K6RXF2
ENSPANP00000004060 XP_007972537.1.81039 XP_010364243.1.97406 XP_011768745.1.29376 XP_011768747.1.29376 XP_011930246.1.92194 XP_011930248.1.92194 XP_014977274.1.72884 XP_015295548.1.63531 XP_017362623.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]