SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004223 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004223
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.29e-24
Family Ribosomal L11/L12e N-terminal domain 0.0000153
Further Details:      
 
Domain Number 2 Region: 74-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000209
Family Ribosomal protein L11, C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004223   Gene: ENSPANG00000006687   Transcript: ENSPANT00000011505
Sequence length 158
Comment pep:novel chromosome:PapAnu2.0:11:31186952:31187446:1 gene:ENSPANG00000006687 transcript:ENSPANT00000011505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKFNPNEIKVYLRCTGGEVGATSMLAPKIGPLGLSPKKAGDDIAKATGDRKVLRITVK
LSIQNRQAQIEVVPSASALTIKALKESPRDRKKQKNIKHNEIIDIAQQMQDLSLARELSG
TIKEILGTAQSVGCNVDGRHPHDMIDDINSGAVECPAS
Download sequence
Identical sequences ENSPANP00000004223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]