SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004259 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004259
Domain Number 1 Region: 32-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-80
Family Calponin-homology domain, CH-domain 0.000087
Further Details:      
 
Domain Number 2 Region: 1332-1444
Classification Level Classification E-value
Superfamily E set domains 3.67e-36
Family Filamin repeat (rod domain) 0.0000249
Further Details:      
 
Domain Number 3 Region: 1844-1955
Classification Level Classification E-value
Superfamily E set domains 6.7e-36
Family Filamin repeat (rod domain) 0.0000035
Further Details:      
 
Domain Number 4 Region: 1522-1641
Classification Level Classification E-value
Superfamily E set domains 1.53e-34
Family Filamin repeat (rod domain) 0.00000873
Further Details:      
 
Domain Number 5 Region: 457-573
Classification Level Classification E-value
Superfamily E set domains 8.01e-33
Family Filamin repeat (rod domain) 0.00034
Further Details:      
 
Domain Number 6 Region: 1435-1543
Classification Level Classification E-value
Superfamily E set domains 1.13e-32
Family Filamin repeat (rod domain) 0.000026
Further Details:      
 
Domain Number 7 Region: 2036-2138
Classification Level Classification E-value
Superfamily E set domains 9.34e-31
Family Filamin repeat (rod domain) 0.0000179
Further Details:      
 
Domain Number 8 Region: 1062-1157
Classification Level Classification E-value
Superfamily E set domains 1.47e-30
Family Filamin repeat (rod domain) 0.0000145
Further Details:      
 
Domain Number 9 Region: 671-779
Classification Level Classification E-value
Superfamily E set domains 2.74e-30
Family Filamin repeat (rod domain) 0.00033
Further Details:      
 
Domain Number 10 Region: 1144-1254
Classification Level Classification E-value
Superfamily E set domains 3.8e-30
Family Filamin repeat (rod domain) 0.000075
Further Details:      
 
Domain Number 11 Region: 850-971
Classification Level Classification E-value
Superfamily E set domains 8.67e-30
Family Filamin repeat (rod domain) 0.00041
Further Details:      
 
Domain Number 12 Region: 1242-1353
Classification Level Classification E-value
Superfamily E set domains 2.74e-29
Family Filamin repeat (rod domain) 0.0000124
Further Details:      
 
Domain Number 13 Region: 554-666
Classification Level Classification E-value
Superfamily E set domains 4.54e-29
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 14 Region: 2233-2328
Classification Level Classification E-value
Superfamily E set domains 2.2e-27
Family Filamin repeat (rod domain) 0.000004
Further Details:      
 
Domain Number 15 Region: 380-479
Classification Level Classification E-value
Superfamily E set domains 8.28e-27
Family Filamin repeat (rod domain) 0.00092
Further Details:      
 
Domain Number 16 Region: 2427-2519
Classification Level Classification E-value
Superfamily E set domains 3.6e-26
Family Filamin repeat (rod domain) 0.00000984
Further Details:      
 
Domain Number 17 Region: 1630-1742
Classification Level Classification E-value
Superfamily E set domains 7.59e-26
Family Filamin repeat (rod domain) 0.0000675
Further Details:      
 
Domain Number 18 Region: 279-375
Classification Level Classification E-value
Superfamily E set domains 4.47e-25
Family Filamin repeat (rod domain) 0.00078
Further Details:      
 
Domain Number 19 Region: 2330-2424
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0000114
Further Details:      
 
Domain Number 20 Region: 2555-2646
Classification Level Classification E-value
Superfamily E set domains 5.4e-24
Family Filamin repeat (rod domain) 0.0000189
Further Details:      
 
Domain Number 21 Region: 948-1065
Classification Level Classification E-value
Superfamily E set domains 2.4e-23
Family Filamin repeat (rod domain) 0.0006
Further Details:      
 
Domain Number 22 Region: 768-869
Classification Level Classification E-value
Superfamily E set domains 3.15e-23
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 23 Region: 2156-2249
Classification Level Classification E-value
Superfamily E set domains 4.94e-21
Family Filamin repeat (rod domain) 0.0000108
Further Details:      
 
Domain Number 24 Region: 1961-2059
Classification Level Classification E-value
Superfamily E set domains 4.54e-18
Family Filamin repeat (rod domain) 0.0000875
Further Details:      
 
Domain Number 25 Region: 1788-1860
Classification Level Classification E-value
Superfamily E set domains 7.37e-16
Family Filamin repeat (rod domain) 0.0000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004259   Gene: ENSPANG00000025614   Transcript: ENSPANT00000011965
Sequence length 2647
Comment pep:novel chromosome:PapAnu2.0:X:141706845:141729476:1 gene:ENSPANG00000025614 transcript:ENSPANT00000011965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSHSRAGQSAAGAAPGGGADTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPTGQKGTVEPQLEARGDSTYRCTYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPTVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGTYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYIICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDMTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPAITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKSHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADAAKVVAKGLGLSKAYIGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
Download sequence
Identical sequences A0A096MWK3
ENSPANP00000004259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]