SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004455 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004455
Domain Number 1 Region: 80-371
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-59
Family Kelch motif 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004455   Gene: ENSPANG00000021002   Transcript: ENSPANT00000007930
Sequence length 390
Comment pep:known_by_projection chromosome:PapAnu2.0:3:151859502:151988616:1 gene:ENSPANG00000021002 transcript:ENSPANT00000007930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAQGWDRNRRRGGGAAGAGGGGSGAGGGSGGSGGRGTGQLNRFVQLSGRPHLPGKKKI
RWDPVRRRFIQSCPIIRIPNRFLRGHRPPPARSGHRCVADNTNLYVFGGYNPDYDESGGP
DNEDYPLFRELWRYHFATGVWHQMGTDGYMPRELASMSLVLHGNNLLVFGGTGIPFGESN
GNDVHVCNVKYKRWALLSCRGKKPSRIYGQAMAIINGSLYVFGGTTGYIYSTDLHKLDLN
TREWTQLKPNNLSCDLPEERYRHEIAHDGQRIYILGGGTSWTAYSLNKIHAYNLETNAWE
EIATKPHEKIGFPAARRCHSCVQIKNDVFICGGYNGEVILGDIWKLNLQTFQWVKLPATM
PEPVYFHCAAVTPPALPHQPSKGLPEKRQL
Download sequence
Identical sequences ENSPANP00000004455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]