SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004551 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004551
Domain Number 1 Region: 8-486
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-161
Family ALDH-like 0.0000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004551   Gene: ENSPANG00000022180   Transcript: ENSPANT00000000129
Sequence length 487
Comment pep:known_by_projection chromosome:PapAnu2.0:4:127545137:127575678:1 gene:ENSPANG00000022180 transcript:ENSPANT00000000129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPG
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
ILHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAIAAGNTVVAKPS
ELTSVTAWMLCTLLDKAGVPPGVVNIVFGTGPTVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY
TEFLKRFVEATRKWKVGIPSDPLASMGALISKAHLEKVRSYIKRALAEGAQIWCGEGVDK
LNLPARSQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITVKH
Download sequence
Identical sequences A0A096MXD8
ENSPANP00000004551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]