SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004708 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004708
Domain Number 1 Region: 173-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-48
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 19-127
Classification Level Classification E-value
Superfamily POZ domain 3.66e-24
Family Tetramerization domain of potassium channels 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004708   Gene: ENSPANG00000000968   Transcript: ENSPANT00000010784
Sequence length 467
Comment pep:known_by_projection chromosome:PapAnu2.0:18:71770877:71804955:1 gene:ENSPANG00000000968 transcript:ENSPANT00000010784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWPCSAGGGGGGTRARHVIINVGGCRVRLAWAALARCPLARLERLRACRGHDELLRVC
DDYDVSRDEFFFDRSPCAFRAIVALLRAGKLRLLRGPCALAFRDELAYWGIDEARLERCC
LRRLRRREEEAAEARAGPAELGAQGSPARALGPRGRLQRGRRRLRDVVDNPHSGLAGKLF
ACVSVSFVAVTAVGLCLSTMPDIRAEEERGECSPKCRSLFVLETVCVAWFSFEFLLRSLQ
AESKCAFLRAPLNIIDILALLPFYVSLLLGLAAGSGGTKLLERAGLVLRLLRALRVLYVM
RLARHSLGLRSLGLTVQRCAREFGLLLLFLCVAMALFAPLVHLAERELGARRDFSSVPAS
YWWAVISMTTVGYGDMVPRSLPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQ
QRATSPEPALREDSTRSATATEDSSQGPDGAGQAADSADALWVRAER
Download sequence
Identical sequences A0A096MXT0
ENSPANP00000004708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]