SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005196 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005196
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000425
Family VPS37 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000157
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005196   Gene: ENSPANG00000022793   Transcript: ENSPANT00000021918
Sequence length 397
Comment pep:known_by_projection chromosome:PapAnu2.0:8:15161236:15211946:1 gene:ENSPANG00000022793 transcript:ENSPANT00000021918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLSKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTAFPYLYSNPSGMPPYASQGFPFLPPYPPQEANRNITSLSVADTVS
SSTTSYTTAKPAAPSFGVLSNLPLPIPTMDASIPTSQNGFGYKMPDVPDAFPELSELSVT
QLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDK
YELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEID
DFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
Download sequence
Identical sequences A0A096MZ12 A0A2K5N9C0 A0A2K5W974 A0A2K5Z4J3 A0A2K6C747 H9FQ28
XP_005562719.1.63531 XP_005562720.1.63531 XP_011709311.1.29376 XP_011834974.1.47321 XP_011949009.1.92194 ENSPANP00000005196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]