SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005262 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005262
Domain Number 1 Region: 987-1126
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.8e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000174
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000791
Family Calponin-homology domain, CH-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005262   Gene: ENSPANG00000014996   Transcript: ENSPANT00000024401
Sequence length 1132
Comment pep:known_by_projection chromosome:PapAnu2.0:19:7263459:7275803:1 gene:ENSPANG00000014996 transcript:ENSPANT00000024401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAHLAVIDALMAAFAFEWTKTLPGPLALTSLEHKLLFWVDTTVRRLQEKTEQEAAQRAS
PAAPADGAAQAQPSHAIAFCLKESGSKPPMIRYRKDRVVARRAPCFPTVTSLQDLASGAA
LAATIHCYCPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPP
PLKVNLVVLLAELFMCFEVLKPDFVQVKDLPDGHAASPRGTEASPPQNNSGSSSPVFNFR
HPLLSPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDV
DVVMGDPVLLRSVSSDSLGPPRPAPARTPTQPPPEPGDLPTIEEALQIIHSAEPRLLPDG
AADGSFYLHSPEGPSKPSLASPYLPEGTSKPLSDRPTKAPVYMPHPETPSKPSPCLVGEA
SKLPAPSEGSPKAVASSPAATNSEVKMTSFAERKKQLVKAEAEAGAGSPTSTPAPPEALS
SEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREASGEAEAEAEPGS
VPGGERPAGEGQGEPTSRPKAVTFSPDLGPVPPEGLGEYNRAVSKLSAALSSLQRDMQRL
TDQQQRLLAPPEAPGPAPPPAAWIIPGPTTGPKAASPSPARRVPANRRSPGPGPSQSPRS
PKHTRPAELRLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEETPPEEPTAR
PGLIEIPLGSLADPAAEDEGDGSPAGAEDSLEEEASSEGEPRAGLGFFYKDEDKPEDEMA
QKRASLLERQQRRVEEARRRKQWQEAEKEQRREEAARLAQEEAPGPAPPVSAVPVAPMAT
PAPAARAPAEEEVGPRKGDFTRQEYERRAQLKLMDDLDKVLRPRAAGSGGPGRGGRRAPR
PRSGCCDDSALARSPARGLLGSRLSKIYSQSTLSLSTVANEAHNNLGVKRPTSRAPSPSG
LMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGK
VNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAM
VEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQGKKPTTPKKGGSTPK
Download sequence
Identical sequences ENSPANP00000005262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]