SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005737 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005737
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 8.76e-23
Family LEM domain 0.000057
Further Details:      
 
Domain Number 2 Region: 107-155
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000549
Family LEM domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005737   Gene: ENSPANG00000019454   Transcript: ENSPANT00000026924
Sequence length 486
Comment pep:known_by_projection chromosome:PapAnu2.0:11:97862347:97894710:1 gene:ENSPANG00000019454 transcript:ENSPANT00000026924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
GPPDFSSDEEREPTPILGSVAAAAGRSRAAVGRKATKKTDKPRQDDKDDLDVTELTNEDL
LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDS
DRYSDNEEGKKKEHKKVKSTRDFVPFSELGTTASGGGFFQDSKIELKLEKREPLKGRAKT
PVTLKQRRVEHNQSYSQAGVTETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHF
RIDGPVISESTPIAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTR
AEVGEKTEERRVERDILKEMFPYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSS
KYVPKYVPLADVKSEKTKKGRSIPVWIKILLFVIVAVFLFLVYQAMETNQVNPFSNFLHV
DPRKSN
Download sequence
Identical sequences ENSPANP00000005737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]