SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005846 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005846
Domain Number 1 Region: 298-558
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-62
Family Kelch motif 0.0000448
Further Details:      
 
Domain Number 2 Region: 30-139
Classification Level Classification E-value
Superfamily POZ domain 8.24e-34
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005846   Gene: ENSPANG00000025374   Transcript: ENSPANT00000008665
Sequence length 586
Comment pep:known_by_projection chromosome:PapAnu2.0:3:87771632:87839535:-1 gene:ENSPANG00000025374 transcript:ENSPANT00000008665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGVEKSSKKKTEKKLAAREEAKLLAGFMGVMNNMRKQKTLCDVILMVQERKIPAHRV
VLAAASHFFNLMFTTNMLESKSFEVELKDAEPDIIEQLVEFAYTARISVNSNNVQSLLDA
ANQYQIEPVKKMCVDFLKEQVDASNCLGISVLAECLDCPELKATADDFIHQHFTEVYKTD
EFLQLDVKRVTHLLNQDTLTVRAEDQVYDAAVRWLKYDEPNRQPFMVDILAKVRFPLISK
NFLSKTVQAEPLIQDNPECLKMVISGMRYHLLSPEDREELVDGTRPRRKKHDYRIALFGG
SQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKD
SWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQR
CSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVK
DKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVG
RLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANEETLET
Download sequence
Identical sequences A0A096N0Q8 A0A0D9RNA4 A0A0P6J4P9 A0A2I3SVQ9 A0A2K5CQJ9 A0A2K5L3H7 A0A2K6FNC4 A0A2K6LAQ5 G1T839 H2PMN8 Q8IXQ5 U3CAU3
ENSPANP00000005846 ENSP00000343273 ENSPPYP00000019879 ENSNLEP00000017918 ENSOCUP00000012711 ENSPPYP00000019879 gi|170784846|ref|NP_001026880.2| ENSPTRP00000032441 9598.ENSPTRP00000032441 9600.ENSPPYP00000019879 9606.ENSP00000343273 9986.ENSOCUP00000012711 ENSP00000323270 NP_001026880.2.87134 NP_001026880.2.92137 XP_002713758.1.1745 XP_002818197.1.23681 XP_003270437.1.23891 XP_003807994.1.60992 XP_004839618.1.39548 XP_006146731.1.99106 XP_007980082.1.81039 XP_011799570.1.43180 XP_011829314.1.47321 XP_011936608.1.92194 XP_012303216.1.9421 XP_012514891.1.63892 XP_017732984.1.44346 XP_527686.2.37143 ENSOCUP00000012711 ENSPTRP00000032441 ENSNLEP00000017922 ENSP00000343273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]