SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005921 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005921
Domain Number 1 Region: 16-191
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.23e-44
Family HD domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005921   Gene: ENSPANG00000016874   Transcript: ENSPANT00000008980
Sequence length 204
Comment pep:known_by_projection chromosome:PapAnu2.0:4:137222937:137249374:1 gene:ENSPANG00000016874 transcript:ENSPANT00000008980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVSSATFLGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMYRMAVMAMVI
KDDRLNKDRCVRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKQITQLLPEDLRKE
LYELWEEYETQSSAEAKFVKQLDQCEMILQASEYEDLEHKPGSLQDFYDSTAGKFNHPEI
VQLVSELEAERNANIAAAASEPHS
Download sequence
Identical sequences A0A096N0Y1 A0A2K5UAF6 F6Q5W6
ENSMMUP00000020085 XP_002803953.1.72884 XP_005551785.1.63531 ENSPANP00000005921 ENSMMUP00000033077 9544.ENSMMUP00000020085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]