SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006296 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006296
Domain Number 1 Region: 901-1193
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.84e-84
Family Complement components 0.0000132
Further Details:      
 
Domain Number 2 Region: 1275-1403
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.62e-31
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 745-790
Classification Level Classification E-value
Superfamily E set domains 0.00000532
Family SVA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006296   Gene: ENSPANG00000025498   Transcript: ENSPANT00000002256
Sequence length 1441
Comment pep:known_by_projection chromosome:PapAnu2.0:4:69393384:69532807:1 gene:ENSPANG00000025498 transcript:ENSPANT00000002256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGQPLLTAAHLLCVCNVSTLALPKPRFLVTTPGIIRPGGNVTIGVELLEHCPSQVTVKA
ELLKTASNLTVSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNST
RLSFETKRISVFIQTDKALYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWL
SQQSDLGVISKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCS
MNSKHLNGTIVAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKIFKINGSVNFSFNDEEMK
NIMDSSNGLSEHLDLAAPGPVEILATVTESLTGIARNASTNVFFKQHDYIIEFFDYTTIL
KPSLNFTATVKVTRADGNQLTLEERRNNVVIAVTQGNYTEYWSGSNSGNQKMETVQKINY
TVPQNGTFKIEFPILEDSSELQLKAYFLGSKSSIAVHSMFKSPSKTYIQLKTRDENIKVG
SPFELVVSGNKRLKELSYMVVSRGQLVAVGKQNSTIFSLTPENSWTPKACVIVYYIEDDG
EIINDVLKIPVQLVFKNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMY
ASNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLTKDYIDGVYDNAEY
AERFMEENEGHVVDIQDFSLGSSPHVRKHFPETWIWLDTNMGSRIYQEFEVTVPDSITSW
VATGFVISEDLGLGLTKTPVELQAFQPNLPYSVIRGEEFALEITIFNYLKDATEVKVIIE
KSDKFDILMTSSEINATGHQQTILVPSEDGATVLFPIRPTHLGEIPITVTALSPTASDAI
TQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAIGDVLG
PSINGLASLIRMPYGCGEQNMIHFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQREL
LYQREDGSFSAFGNYDASGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKERQKSNG
EFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYRKYQPNIDVQESIHFLESEFSRGISD
NYTLALIAYALSSVGSPKAKEALNMLTSRAEQEGGMQFWVSSESKLSDSWQPRSLDIEVA
AYALLSHFLQFQASEGIPIMRWLSRQRNSLGGFASTQQDTIVALKALSEFAALMITERTN
IQMTVTGPNAPSPITFLIDTHNRLLLQTAELAVVQPTAVNIFANGFGFAICQLNVVYNVK
DSGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTRFLGPARSGMALMEVNLLSGF
MVPSDTIPLSETVKKVEYDHGKLNLYLDSVNETQFCVDIPAVRNFKVSNTQDASVSIVDY
YEPRRQAVRSYNSEAKLSSCDLCSDVQGCRPCEDGAVGSHHHPSVIFIFCFTLLYFLELW
L
Download sequence
Identical sequences ENSPANP00000006296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]