SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006567 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006567
Domain Number 1 Region: 151-246
Classification Level Classification E-value
Superfamily S13-like H2TH domain 7.46e-22
Family Middle domain of MutM-like DNA repair proteins 0.013
Further Details:      
 
Domain Number 2 Region: 48-109
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000484
Family N-terminal domain of MutM-like DNA repair proteins 0.011
Further Details:      
 
Domain Number 3 Region: 314-341
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000549
Family Ran binding protein zinc finger-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006567   Gene: ENSPANG00000014727   Transcript: ENSPANT00000012049
Sequence length 602
Comment pep:known_by_projection chromosome:PapAnu2.0:5:166578016:166634568:1 gene:ENSPANG00000014727 transcript:ENSPANT00000012049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALPLAASTAVVSPQASALNNND
ASSLFNGYVYSGVETLGKELFMYFGPKAFRIHFGMKGSIMINPLECKYKNGASPVLEVQL
TKDLICFFDSSVELRNSMESQQRVGMMKELDVCSPEFSFLRAENEVKKQKGRMLGDVLMD
QNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQTHHLVKMIRDFSILFYRCRKAGLAVS
KHYKVYKRPNCGQCHCRITVCRFGDNNRITYFCPRCQKENPQHVDICRLPTRNTIISWTS
SRVDHVMDSVARKSEEQWTCAVCTLINKPSSKACDACLTSRPIDSVLKNEENSTVFSHLM
KYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSSKSSTLEIKKKQNQTLDKEFQNSPPTN
VCLKDTQHPSKKRTNNITQLSSKVNISPTISSESKLFSPAHKKLKTAHCSSPDLKSCNPG
YSSSELQINVTDGPGTLNPDGPRCSKHSRLCILRVVRKDGENKGRQFYACPLPREAQCGF
FEWADLSFPFCNHGKRSIMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGMKIIP
GC
Download sequence
Identical sequences A0A096N2M3
ENSPANP00000006567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]