SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006568 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006568
Domain Number 1 Region: 52-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.65e-72
Family Calnexin/calreticulin 0.0000000389
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.19e-59
Family P-domain of calnexin/calreticulin 0.000000283
Further Details:      
 
Domain Number 3 Region: 383-428
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.00000471
Family P-domain of calnexin/calreticulin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006568   Gene: ENSPANG00000012438   Transcript: ENSPANT00000019234
Sequence length 475
Comment pep:known_by_projection chromosome:PapAnu2.0:5:130763107:130782138:-1 gene:ENSPANG00000012438 transcript:ENSPANT00000019234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFQAFWLCLGLLFISINAEFMDDDVEMEHLEENSEETDVNEGELSSEIKYKTPQPIGEV
YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHH
AISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDRTSYIIMF
GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFE
VLVDQTVVNKGSLLEDVVPPINPPKEIEDPSDKKPEEWDERAKIPDPSAVKPEDWDESEP
AQIEDSSAVKPAGWLDDEPKFIPDPNAEKPDDWNEDMDGEWEAPHILNPACRIGCGEWKP
PMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTS
DIYFDNFIICSEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
Download sequence
Identical sequences ENSPANP00000006568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]