SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006636 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006636
Domain Number 1 Region: 55-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000828
Family NQO2-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006636   Gene: ENSPANG00000014192   Transcript: ENSPANT00000015122
Sequence length 156
Comment pep:known_by_projection chromosome:PapAnu2.0:1:154865692:154866784:1 gene:ENSPANG00000014192 transcript:ENSPANT00000015122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKEDLTPKDIEEIIDELKAGKI
PKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Download sequence
Identical sequences ENSPANP00000006636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]