SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006677 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006677
Domain Number 1 Region: 434-922
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-166
Family ALDH-like 0.000000000696
Further Details:      
 
Domain Number 2 Region: 23-223
Classification Level Classification E-value
Superfamily Formyltransferase 5.63e-50
Family Formyltransferase 0.0000000191
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.3e-25
Family Post formyltransferase domain 0.0000137
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006677
Domain Number - Region: 346-418
Classification Level Classification E-value
Superfamily ACP-like 0.0037
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006677   Gene: ENSPANG00000018236   Transcript: ENSPANT00000015314
Sequence length 923
Comment pep:known_by_projection chromosome:PapAnu2.0:11:104248042:104310563:-1 gene:ENSPANG00000018236 transcript:ENSPANT00000015314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWGSQALRRFSTGQVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGADLNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMILASQYFSAGETSVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGKD
QEAELVVDYVSKEVNEMMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHVGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELEKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences A0A096N2X9
ENSPANP00000006677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]