SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006727 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006727
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.6e-62
Family Alanine racemase-like, N-terminal domain 0.000000122
Further Details:      
 
Domain Number 2 Region: 248-409
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.91e-33
Family Eukaryotic ODC-like 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006727   Gene: ENSPANG00000002432   Transcript: ENSPANT00000021577
Sequence length 446
Comment pep:known_by_projection chromosome:PapAnu2.0:8:98100374:98131050:-1 gene:ENSPANG00000002432 transcript:ENSPANT00000021577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFIDDANYSVGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNVVA
QIKPFYTVKCNSAPAVLEILAALGTGFACSSKNEMALVQELGVSPENIIYISPCKQVSQI
KYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCKHL
LECAKELDVQIIGVKFHVSSACKESQVYVHALSDARCVFDMAGEIGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDIYFPEGSGVKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFPS
GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPEVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYYMMSFSDCMNADAGIT
SDSMMRLLLCASCIQLSQETSFSLKL
Download sequence
Identical sequences ENSPANP00000006727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]