SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007109 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007109
Domain Number 1 Region: 44-231
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.23e-40
Family PaaI/YdiI-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007109   Gene: ENSPANG00000009760   Transcript: ENSPANT00000009620
Sequence length 240
Comment pep:known_by_projection chromosome:PapAnu2.0:1:125687744:125736912:-1 gene:ENSPANG00000009760 transcript:ENSPANT00000009620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSCAARLRTLGALRGPPGGRRLPGREPRPALRSFSSEEVILKDYSVPNPSWNKDLRLL
FDQFMKKCEDGSWKRLPSYKRIPAEKIQDFKTHLLDPKLVKEEQMSQTQLFTRSFDDGLG
FEYVMFYSDVEKRMVCLFQGGPYLEGPPGFVHGGAIATIIDSTVGMCALMAGGVVVTANL
NINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEQTLYSEATSIFIKLNPAKSLT
Download sequence
Identical sequences A0A096N413
ENSPANP00000007109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]