SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007321 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000007321
Domain Number - Region: 109-166
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00157
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007321   Gene: ENSPANG00000016875   Transcript: ENSPANT00000008385
Sequence length 251
Comment pep:known_by_projection chromosome:PapAnu2.0:3:44731098:44734604:1 gene:ENSPANG00000016875 transcript:ENSPANT00000008385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLAS
NYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQ
AELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQ
PAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLS
PRPSQPEPPHR
Download sequence
Identical sequences A0A096N4K3 A0A0D9S005 A0A2I3SYZ7 A0A2J8XV00 A0A2K5RYC7 G3QGH6 I0FPI3 Q86XT2
ENSPANP00000007321 ENSPTRP00000032946 ENSGGOP00000001434 NP_001071089.1.87134 NP_001071089.1.92137 XP_004045609.1.27298 XP_008016535.1.81039 XP_009451595.1.37143 XP_014988810.1.72884 XP_016800781.1.37143 XP_017388913.1.71028 ENSP00000320416 ENSP00000461461 ENSP00000320416 9606.ENSP00000320416 ENSGGOP00000001434 gi|117938318|ref|NP_001071089.1| ENSP00000320416 ENSP00000458873 ENSPTRP00000032946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]