SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007432 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007432
Domain Number 1 Region: 622-1146
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-149
Family alpha-mannosidase, C-terminal domain 0.000000974
Further Details:      
 
Domain Number 2 Region: 123-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.18e-136
Family alpha-mannosidase 0.00000000157
Further Details:      
 
Domain Number 3 Region: 502-614
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 5.89e-31
Family alpha-mannosidase, domain 2 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007432   Gene: ENSPANG00000008221   Transcript: ENSPANT00000025089
Sequence length 1147
Comment pep:known_by_projection chromosome:PapAnu2.0:6:103347695:103520821:1 gene:ENSPANG00000008221 transcript:ENSPANT00000025089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRNPRREGSFPQGQLSMLQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPKSSQSNFSQGAGSRLLPSQLSLSVDTADCLFAS
QSGSHNSDVQMLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGW
LKTFNDYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSLIEN
GQLEIVTGGWVMPDEATAHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTMAYL
LNRAELSHMLIQRVHYAVKKHFAQHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTC
GPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRAQMLLDQYRKKSKLFRTKVLL
APLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRD
KGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAH
KYKINKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMVLEKIIG
TSAFFLILKDKLTYDSYSSDTFLEMDLKQKSQDSLPQKNIIRLSAEPRYLVVYNPLEQDR
ISVVSVYVSSPTVQVFSASGKPVEVQVSAVWDTANTISETAYEISFRAHIPPLGLKVYKI
LESASSNSHLADYVLYNNKVEDRGIFTIKNMINTEEGITLENSFVLLRFDQTGLMKQMMT
KEDGKHHEVSVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTC
FFDHVTHRVRLYHIQVGIEGQSVEVSNIVDIRKVYNREIAMKISSDIKSQNRFYTDLNGY
QIQPRMTLSKLPLQANVYPMTTMAYIQDAKHRLTLLSAQSLGVSSLNSVLGQIEVIMDRR
LMQDDNRGLEQGVQDNKITANLFRILLEKRSAVNTEEEKNSVSYPSLLSHITSSFMNHPV
FPMANKFSSPTLDLQGEFSPLQSSLPCDIHLVNLRTIQSKVGSGHSNEAALILHRKGFDC
RFSSKGTGLFCSTTQGKMLVQKLFNKFIVESLTLSSLSLMHSPPGTQNISEINLSPMEIS
TYRIRLR
Download sequence
Identical sequences ENSPANP00000007432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]