SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007495 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007495
Domain Number 1 Region: 344-624
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.47e-86
Family Eukaryotic proteases 0.000000000491
Further Details:      
 
Domain Number 2 Region: 105-193
Classification Level Classification E-value
Superfamily Kringle-like 1.33e-28
Family Kringle modules 0.0000115
Further Details:      
 
Domain Number 3 Region: 214-303
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-28
Family Kringle modules 0.0000097
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 1.11e-19
Family GLA-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007495   Gene: ENSPANG00000016657   Transcript: ENSPANT00000025347
Sequence length 628
Comment pep:known_by_projection chromosome:PapAnu2.0:14:18442297:18461971:-1 gene:ENSPANG00000016657 transcript:ENSPANT00000025347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQALSLLQRVRRASSGFLEEVLKGNLERE
CMEEMCSYEEAFEALESSTATDAFWAKYTACETVRTSRDTLAACLEGNCAEGLGTNYGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDGSTTGPWCYTTDPTVRREE
CSIPVCAHPPGQDQVTVAMTPRSRGSSVNLSLPSEECVPDRGRQYQGRLAVTTHGLPCLA
WDSTQAKALSKHQDFDSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFEYCDLNYCEEAVD
EETGDGLGEDTDRAIEGRTATSEYQTFFDPRTFGLGEADCGLRPLFEKKSLEDKTEGELL
ESYIDGRIVEGWDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKN
FTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVTFSD
YIHPVCLPDRETAASLFQAGYKGRVTGWGNLKETWTANVGKVQPSVLQVVNLPIVERSVC
KDSTRIRITDNMFCAGKGYKPGEGKRGDACEGDSGGPFVMKNPLNKRWYQMGIVSWGEGC
DRDGKYGFYTHVFRLKKWIQKVIDQFGD
Download sequence
Identical sequences ENSPANP00000007495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]