SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007539 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007539
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.26e-99
Family Iron-containing alcohol dehydrogenase 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007539   Gene: ENSPANG00000018057   Transcript: ENSPANT00000001688
Sequence length 467
Comment pep:known_by_projection chromosome:PapAnu2.0:8:62375619:62414048:1 gene:ENSPANG00000018057 transcript:ENSPANT00000001688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARARVAHLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAGV
TKEVGMDLQNMGAKNVCLMTDKNLSQLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDASFM
EAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKP
LIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLIDPLHTLHMPARVVANSG
FDVLCHALESYTALPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRN
PDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMFPERHLETAEILGADTRTTRIQDAGLVLADTLRKFLFDLDVDDGL
AAIGYSKADIPALVKGTLPQERVTKLAPRPQSEEDLAALFEASMKLY
Download sequence
Identical sequences A0A096N534
ENSPANP00000007539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]