SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007569 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007569
Domain Number 1 Region: 115-166
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000981
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007569   Gene: ENSPANG00000004641   Transcript: ENSPANT00000014664
Sequence length 294
Comment pep:known_by_projection chromosome:PapAnu2.0:11:122178688:122183629:-1 gene:ENSPANG00000004641 transcript:ENSPANT00000014664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGVEEGAASRETDIHWVRNRVLLKLTVWNDRGGSGLGCGRGSRSPTQNVQLNKEMTLAS
NRSLAEGNLLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQ
AEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQ
ALAPLPPRLPELAPTAPLPYPAPEASGPPTVAPRRIPPPPPPVPAGRLATPFTAAMSSGQ
AVQYPGLQCPPLPPRVGLATQQGFSSQFMSPYPPALPQRPPPRLPPHQPGFILQ
Download sequence
Identical sequences ENSPANP00000007569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]