SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007637 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007637
Domain Number 1 Region: 66-103
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000235
Family Ribosomal protein L36 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007637   Gene: ENSPANG00000004169   Transcript: ENSPANT00000029171
Sequence length 103
Comment pep:known_by_projection chromosome:PapAnu2.0:6:1621271:1621579:-1 gene:ENSPANG00000004169 transcript:ENSPANT00000029171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLFIRKMVNPLLYLSRHTVKPRVLSTFLMGSLRGAAPVAVKAGAEARSLLSPGLLPRL
LPALSFKSKVVLKKRCRDCYLVKRRGRWYVYCKTNPRHKQRQM
Download sequence
Identical sequences ENSPANP00000007637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]