SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007681 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007681
Domain Number 1 Region: 34-520
Classification Level Classification E-value
Superfamily ALDH-like 5.24e-144
Family ALDH-like 0.000000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007681   Gene: ENSPANG00000000641   Transcript: ENSPANT00000013678
Sequence length 537
Comment pep:known_by_projection chromosome:PapAnu2.0:7:130127803:130150446:-1 gene:ENSPANG00000000641 transcript:ENSPANT00000013678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVAAAAAAVRARILQVSSKVKCNSAWYSASSFSSSVPAVKLFIDGKFVESKSDKWIE
IHNPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKE
IAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGV
CAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNII
HGQHEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANK
ENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVERAKNLRVNAGDQPGADLGPL
ITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEI
FGPVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVP
LPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVAMPTMGR
Download sequence
Identical sequences A0A096N5G8
ENSPANP00000007681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]