SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007697 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007697
Domain Number 1 Region: 298-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.81e-76
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 174-279
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-32
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 73-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000381
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 113-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000247
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007697   Gene: ENSPANG00000020791   Transcript: ENSPANT00000022353
Sequence length 560
Comment pep:known_by_projection chromosome:PapAnu2.0:9:105199015:105234724:1 gene:ENSPANG00000020791 transcript:ENSPANT00000022353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFARTSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNPEENTSSTLT
HPENPDWYYTEDQADPCQPNPCEHGGDCLVHGRTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNSGTCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQESYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVSNDKVKWEYCDVSACAAQDIAYPEEIPTEPSTKLLGFDS
CGKTEIAERKIKKIYGGFKSTAGKHPWQASLQSSLPLTVSMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQIFRVEKIFKYTHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLISNTLCNSR
QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGTRPGVY
TQVTKFLNWIKATIKSESGF
Download sequence
Identical sequences A0A096N5I4
ENSPANP00000007697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]