SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007966 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000007966
Domain Number - Region: 111-179
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.012
Family FCH domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007966   Gene: ENSPANG00000017446   Transcript: ENSPANT00000002399
Sequence length 196
Comment pep:known_by_projection chromosome:PapAnu2.0:11:12018986:12125145:1 gene:ENSPANG00000017446 transcript:ENSPANT00000002399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGVDQTVPLLDRLNSLLPES
ERLEPFSMKPDRELRL
Download sequence
Identical sequences A0A0D9R8C7 A0A1D5QQA7 A0A2I3N5L7 A0A2K5IYL2 A0A2K5N5Y2 A0A2K5Y9I1 A0A2K6E6Y9 G7PJV8
9544.ENSMMUP00000024435 ENSMMUP00000024435 NP_001248576.1.72884 XP_007965888.1.81039 XP_011740524.1.29376 XP_011809206.1.43180 XP_011849029.1.47321 XP_011913928.1.92194 ENSMMUP00000024435 ENSPANP00000007966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]