SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008101 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008101
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.39e-16
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 2.62e-16
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008101   Gene: ENSPANG00000002488   Transcript: ENSPANT00000000749
Sequence length 109
Comment pep:known_by_projection chromosome:PapAnu2.0:8:89812263:89812589:1 gene:ENSPANG00000002488 transcript:ENSPANT00000000749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLRNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRV
FLNTYRFCDNVWTFVLNDVEFREVTELTKVDKVKIVACDGKNTGSNTTE
Download sequence
Identical sequences ENSPANP00000008101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]