SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008248 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008248
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-76
Family Phosphate binding protein-like 0.00000333
Further Details:      
 
Domain Number 2 Region: 239-297,331-352
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 2.22e-19
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008248   Gene: ENSPANG00000004726   Transcript: ENSPANT00000003157
Sequence length 361
Comment pep:known_by_projection chromosome:PapAnu2.0:14:108422322:108430576:1 gene:ENSPANG00000004726 transcript:ENSPANT00000003157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPH
DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFSHLEFRSIRGNLNTRLRKLDEQ
QEFSAIILATAGLQRMGWHNRVGQILPPEECMYAVGQGALGVEVRAKDQDILDLVGVLHD
PETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQDTMQATIH
VPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDA
H
Download sequence
Identical sequences A0A096N6W7
ENSPANP00000008248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]