SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008259 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008259
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.1e-27
Family Ribosomal L11/L12e N-terminal domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 75-149
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000000235
Family Ribosomal protein L11, C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008259   Gene: ENSPANG00000005052   Transcript: ENSPANT00000011132
Sequence length 166
Comment pep:known_by_projection chromosome:PapAnu2.0:1:18249507:18250324:1 gene:ENSPANG00000005052 transcript:ENSPANT00000011132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKFNPNEIKVVYLRCTGGEGGTTSALAPKMGPLDLSPKKIGSNIAKATDDWKGLKITV
KLTIQNRQAQIEVVPSAYAPIIKALKEPPTDRKKQKNIKHRGNNITFDEIVNIARQMWHR
SLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences ENSPANP00000008259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]