SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008531 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008531
Domain Number 1 Region: 10-268
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 5.18e-85
Family Phosphoglycerate kinase 0.00000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008531   Gene: ENSPANG00000010110   Transcript: ENSPANT00000006741
Sequence length 268
Comment pep:novel chromosome:PapAnu2.0:19:11349055:11350177:1 gene:ENSPANG00000010110 transcript:ENSPANT00000006741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCISKMSLSNKLTLDKLDVKGKPVIIRVDFNVPMKNNQITNNQRIKAAAPSIKFCLDNGS
KSVVLMRHLGRPEGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPVCFFVFVFVFCMK
KELNYFAKDLESPERHFLAILGRAKVADKIQLIKNMLDKVNEMIIGGGMAFTFLKVLNNM
EIGTSLFDEEGAKIVKDLMSKAEKNGVKIILPVDFVAAGKFDENAKTDQATVASGISAGR
MGLDCGPESSKKYAEAVTRAKQIVWNGP
Download sequence
Identical sequences ENSPANP00000008531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]