SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008614 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008614
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.44e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.31e-18
Family Ribosomal protein L11, C-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008614   Gene: ENSPANG00000007304   Transcript: ENSPANT00000002966
Sequence length 165
Comment pep:novel chromosome:PapAnu2.0:9:20713030:20713631:1 gene:ENSPANG00000007304 transcript:ENSPANT00000002966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNMKHSGNITFDEIINIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIVDINSGAVECPAS
Download sequence
Identical sequences A0A096N7R0
ENSPANP00000008614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]