SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008987 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008987
Domain Number 1 Region: 307-574
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-65
Family Kelch motif 0.0000565
Further Details:      
 
Domain Number 2 Region: 22-142
Classification Level Classification E-value
Superfamily POZ domain 1.88e-34
Family BTB/POZ domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008987   Gene: ENSPANG00000003224   Transcript: ENSPANT00000016158
Sequence length 589
Comment pep:known_by_projection chromosome:PapAnu2.0:6:68719875:68721644:-1 gene:ENSPANG00000003224 transcript:ENSPANT00000016158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCH
RAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESL
LEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIR
KNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLPELLQTVRLAL
LPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL
GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWV
YDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPT
TNKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQ
PWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKL
YVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS
Download sequence
Identical sequences A0A0D9SDI4 A0A1S3FVV2 A0A2K5C5Y9 A0A2K5HQY6 A0A2K5KXJ4 A0A2K5PHQ7 A0A2K5XNB2 A0A2K6AQX3 A0A2K6GPM8 A0A2K6JP11 A0A2K6NSM7 A0A2K6SA78 D2H679 E2QV71 F6X122 F7ANZ0 F7FNH4 G1P336 G1QY18 G3QKT4 G7P7Q8 H0WZK5 H2PFV2 H2QR29 M3XDE8 M3Z520 S9W8N0
ENSAMEP00000020097 ENSFCAP00000024654 ENSDORP00000015267 ENSCJAP00000030656 ENSMMUP00000026293 ENSPVAP00000008399 ENSPVAP00000008399 ENSGGOP00000003069 ENSMPUP00000018682 ENSPTRP00000029092 ENSMMUP00000026293 ENSPANP00000008987 ENSSSCP00000014964 ENSSSCP00000014964 ENSNLEP00000005839 ENSAMEP00000020097 ENSMLUP00000004313 ENSOGAP00000008028 ENSCAFP00000012165 ENSMLUP00000004313 ENSECAP00000014252 ENSECAP00000014252 ENSOGAP00000008028 ENSMICP00000000666 ENSGGOP00000025902 ENSMPUP00000018682 ENSMICP00000000666 ENSPTRP00000029092 ENSPPYP00000017388 ENSCJAP00000030656 ENSCAFP00000012165 9544.ENSMMUP00000026293 9598.ENSPTRP00000029092 9600.ENSPPYP00000017388 9615.ENSCAFP00000012165 9796.ENSECAP00000014252 9823.ENSSSCP00000014964 ENSDORP00000015267 NP_001247512.1.72884 XP_001918381.1.31192 XP_002744911.1.60252 XP_002815692.1.23681 XP_002917253.1.58354 XP_003123749.1.46622 XP_003266114.1.23891 XP_003310724.1.37143 XP_003785958.1.62490 XP_003810517.1.60992 XP_003920898.1.74449 XP_004058746.1.27298 XP_004416176.1.74151 XP_004766921.1.14098 XP_005557203.1.63531 XP_005858092.1.60319 XP_005858093.1.60319 XP_005858094.1.60319 XP_006081390.1.53796 XP_006081391.1.53796 XP_006081392.1.53796 XP_006167857.1.99106 XP_006195432.1.101512 XP_006197640.1.17985 XP_006735134.1.47382 XP_006775502.1.95426 XP_006775503.1.95426 XP_006775504.1.95426 XP_006913202.1.64745 XP_006927852.1.62641 XP_007079909.1.5354 XP_007973462.1.81039 XP_008160157.1.99482 XP_008535575.1.77740 XP_008689522.1.72690 XP_010361650.1.97406 XP_010361656.1.97406 XP_010947596.1.22495 XP_010973298.1.51371 XP_011371015.1.92234 XP_011728481.1.29376 XP_011814644.1.43180 XP_011814646.1.43180 XP_011852033.1.47321 XP_011852039.1.47321 XP_011944706.1.92194 XP_012317593.1.9421 XP_012352822.1.23891 XP_012520061.1.63892 XP_012577393.1.23501 XP_012639045.1.48125 XP_012880696.1.60039 XP_013964567.1.84170 XP_014685585.1.49734 XP_014927617.1.86478 XP_015977661.1.101085 XP_015977662.1.101085 XP_015977663.1.101085 XP_017383132.1.71028 XP_017746096.1.44346 XP_019318566.1.44245 XP_019496629.1.44202 XP_019583680.1.88060 XP_020010759.1.5219 XP_020940106.1.46622 XP_021555820.1.83697 XP_021555827.1.83697 ENSPPYP00000017388 ENSNLEP00000005839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]