SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008996 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008996
Domain Number 1 Region: 68-304
Classification Level Classification E-value
Superfamily PLP-binding barrel 5.98e-71
Family Alanine racemase-like, N-terminal domain 0.000000161
Further Details:      
 
Domain Number 2 Region: 281-437
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.91e-35
Family Eukaryotic ODC-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008996   Gene: ENSPANG00000021935   Transcript: ENSPANT00000025283
Sequence length 442
Comment pep:novel chromosome:PapAnu2.0:1:33711839:33721404:1 gene:ENSPANG00000021935 transcript:ENSPANT00000025283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPHPVEGSVGVSGMSTCLEGLKEAHGRPWPKELIALGPEESAQQMVLRRIQELSDSDQ
QDPFMLADLDILASRHQAFCQALPQVSPFYAVKCNSSPWVLRVLAALGTGFDCASQVELE
QVLGLGVAPSRIIYANPCKPASHIRYAARHGVQLLTFDSEEELTKVAQHHPGARLLLRLR
TQDSQSTFPLSTKFGASLEACGHLLTSARDLGLAVVGASFHVGSNCQTPQSFTQAIADCR
CVFEMGRGAGHDMSCLDIGGGFPGTEDSGPKFEEMARVISAALAQDFPEERGVKVIAEPG
RFYMESVCTAAVNIIAKKAVLEPGGSRKLMYYLNDGHYGSFRLGHREPVPRVPIVVKEFC
SEPPLFPCTLYGPTCDASDRLFLEDVRLPELDVGDWLVFPSMGAYTSSMSCSFNGFLPAT
ICYTMGPQLRSLLEAEPESRVG
Download sequence
Identical sequences A0A096N8R5
ENSPANP00000008996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]