SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009016 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009016
Domain Number 1 Region: 237-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.12e-57
Family Decarboxylase 0.000000496
Further Details:      
 
Domain Number 2 Region: 15-204
Classification Level Classification E-value
Superfamily PRTase-like 2.41e-44
Family Phosphoribosyltransferases (PRTases) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009016   Gene: ENSPANG00000019863   Transcript: ENSPANT00000009173
Sequence length 480
Comment pep:known_by_projection chromosome:PapAnu2.0:2:44238227:44256814:1 gene:ENSPANG00000019863 transcript:ENSPANT00000009173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGGALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADVLFQT
AQNAGINFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKML
EILEQQKKIDAETVGRVKRFIQENVFVAANHNGSALSIKEAPRELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRGCLLIAEMSSSGSLATGNYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Download sequence
Identical sequences A0A096N8T5
ENSPANP00000009016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]