SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009050 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009050
Domain Number 1 Region: 295-356
Classification Level Classification E-value
Superfamily RILP dimerisation region 6.28e-18
Family RILP dimerisation region 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009050   Gene: ENSPANG00000015966   Transcript: ENSPANT00000026094
Sequence length 411
Comment pep:known_by_projection chromosome:PapAnu2.0:11:122800145:122854710:-1 gene:ENSPANG00000015966 transcript:ENSPANT00000026094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRV
LEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLL
SQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAK
DRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEM
GSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAEKVAMELKDPNRPRFTLQELR
DVLHERNELKSKLFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPESGIKRLKEGP
LSDGFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL
Download sequence
Identical sequences A0A096N8W9 A0A2K5ML73
ENSPANP00000009050 XP_011926761.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]