SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009080 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009080
Domain Number 1 Region: 5-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 3.65e-165
Family Phosphoglycerate kinase 0.000000000000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009080   Gene: ENSPANG00000001886   Transcript: ENSPANT00000012030
Sequence length 417
Comment pep:novel chromosome:PapAnu2.0:7:36113802:36115055:1 gene:ENSPANG00000001886 transcript:ENSPANT00000012030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKMDVKGKLVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLE
NLHFHVEEERKGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMKKELNYFAKALESPERPFLAILGEAKVADKIQLINNMLDKVNKMIFGGGM
AFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGLDCGPESSKKYAEAVTWAKQIVWNGPVGVFEWEAFARGTKALMDEVV
KATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI
Download sequence
Identical sequences A0A096N8Z9
ENSPANP00000009080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]