SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009089 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009089
Domain Number 1 Region: 327-608
Classification Level Classification E-value
Superfamily Kelch motif 1.27e-85
Family Kelch motif 0.0000000000268
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 5.76e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009089   Gene: ENSPANG00000003566   Transcript: ENSPANT00000008894
Sequence length 624
Comment pep:known_by_projection chromosome:PapAnu2.0:19:9433984:9444212:-1 gene:ENSPANG00000003566 transcript:ENSPANT00000008894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDPKPSRAGACSRFLPLRSQCPEGSGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAERYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences A0A0A0MWA2 A0A0D9R445 A0A2K6DK25 G7NL03
ENSPANP00000009089 XP_007993419.1.81039 XP_007993421.1.81039 XP_011729374.1.29376 XP_011729445.1.29376 XP_011729510.1.29376 XP_011729558.1.29376 XP_014978344.1.72884 XP_014978345.1.72884 XP_014978346.1.72884 XP_014978347.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]