SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009172 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009172
Domain Number 1 Region: 30-547
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-123
Family ALDH-like 0.000000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009172   Gene: ENSPANG00000007823   Transcript: ENSPANT00000016823
Sequence length 563
Comment pep:known_by_projection chromosome:PapAnu2.0:1:21161383:21195833:-1 gene:ENSPANG00000007823 transcript:ENSPANT00000016823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPASALRRALLSRPWTGAGLQWKHTSSLKVANEPILAFTQGSPEREALQKALKDLKGR
TEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKP
IADRAQIFLKAADMLSGPHRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVEL
EGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAML
ASYAVYRVLREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQ
NLDRFRTFPRLAGECGGKNFHFVHCSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPHSL
WPQIKGRLLEEHGRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLTVYVYPDDKYKETLQLVDSTTSYGLTG
AVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILR
WTSPQVIKETHKPLGDWSYAYMQ
Download sequence
Identical sequences A0A096N969
ENSPANP00000009172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]