SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009184 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009184
Domain Number 1 Region: 24-163
Classification Level Classification E-value
Superfamily dUTPase-like 2.36e-48
Family dUTPase-like 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009184   Gene: ENSPANG00000005473   Transcript: ENSPANT00000028346
Sequence length 164
Comment pep:novel scaffold:PapAnu2.0:JH685184.1:9459:9953:-1 gene:ENSPANG00000005473 transcript:ENSPANT00000028346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCSEETPAISPSKRPRPAEEGGMQLRFARLSKHATAPTRGSARAAGYDLYSAYDYTIPP
MEKALVKTNIQIALPSGCYGRVAPGSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEK
FEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Download sequence
Identical sequences ENSPANP00000009184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]