SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009193 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009193
Domain Number 1 Region: 107-191
Classification Level Classification E-value
Superfamily E set domains 0.00000000222
Family Filamin repeat (rod domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009193   Gene: ENSPANG00000004639   Transcript: ENSPANT00000020862
Sequence length 559
Comment pep:known_by_projection chromosome:PapAnu2.0:14:104080476:104104695:1 gene:ENSPANG00000004639 transcript:ENSPANT00000020862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEKIFIHRILTLFPNAIARKLLLMLIFILIFWVIYLASKDHTKFLFSLENHITLNQGNI
FKKSSHSEAPLCPAVSPKETELRIKDIMEKLDQQIPPRPFTHVNTTTSATHSTATILNPQ
DTYCRGDKLDILLEVRDHLGRRKQYGGDFLRARMSSPALMAGASGKVTDFNNGTYLVSFT
LFWEGQISLSLLLIHPSEGVSALWRARNQGCDKIIFIGLFANRTSNVFTECGLTLNTNAE
LCQYMDDRDHEAFYCVRPQHMPCESLTHVTTRTRNISCLSKEEWSLFHRSNIGVEMMKNF
TPVEVVPCNKSENIKKNCQIGMKTPFPSGYTLKKMWITAFCKQIKFNETKNINDCLERKL
IYLMGDSTLRQWIYYLQKAVKTLKYFDHHGAGIFKTHVLLDVERHILIQWKKHGHPFVTK
KLFSVKDENYIPREIDRVAGDKNTAIVITLGQHFRPFPINIFIRRAINIQKAIERLFLRS
PETKVILKTENTREIHQNAEMFSDFHGYIQNIIIRDIFVDLNVGIIDAWDMTIAYCTNNA
HPPDYVIQNQIGMFLNYIC
Download sequence
Identical sequences A0A096N988
ENSPANP00000009193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]