SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009199 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009199
Domain Number 1 Region: 118-383
Classification Level Classification E-value
Superfamily Kelch motif 1.02e-83
Family Kelch motif 0.00000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009199   Gene: ENSPANG00000008914   Transcript: ENSPANT00000023647
Sequence length 433
Comment pep:known_by_projection chromosome:PapAnu2.0:1:196409356:196476173:1 gene:ENSPANG00000008914 transcript:ENSPANT00000023647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLP
LLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIRCGEVL
FAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLN
SVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQDGVSCLNIVERYDPKENKW
TRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHL
GCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVG
GFDGTTYLKTIEVFDPDANTWRYSRLLTNTKGYKKRTCNCEHWGTFLRGGVGINEVCFLI
DSNRFCRGVAPTK
Download sequence
Identical sequences ENSPANP00000009199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]