SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009258 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009258
Domain Number 1 Region: 468-960
Classification Level Classification E-value
Superfamily ALDH-like 1.05e-152
Family ALDH-like 0.00000000121
Further Details:      
 
Domain Number 2 Region: 53-253
Classification Level Classification E-value
Superfamily Formyltransferase 3.01e-51
Family Formyltransferase 0.0000000024
Further Details:      
 
Domain Number 3 Region: 257-360
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.61e-23
Family Post formyltransferase domain 0.0000013
Further Details:      
 
Domain Number 4 Region: 379-457
Classification Level Classification E-value
Superfamily ACP-like 0.0000109
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009258   Gene: ENSPANG00000021688   Transcript: ENSPANT00000000575
Sequence length 961
Comment pep:known_by_projection chromosome:PapAnu2.0:2:45350365:45431107:-1 gene:ENSPANG00000021688 transcript:ENSPANT00000000575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSRTGGDRSHLLATRTGRHQPQFRGCGSQKSNLPATPAPTPARGPSNPPATMKIAVIGQ
SLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKFSRWRAKGQALPE
VVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLLPRHRGASAINWTLIHGDK
KGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKA
PRLPQPEEGATYEGIQKKETAKIDWDQPAEAIHNWIRGNDKVPGAWTEACEPLQKLTFFN
STLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMILASNFF
KGAASSALELTEAELVTAEAVRSAWQRILPNVLEVEDSTDFFKSGAASVDVVRLVEEVKE
LCDGLELENEDVYMATTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTLHMPHQLFI
GGAFVDADGAKTYETINPTDGSVICRVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRG
RLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIP
INQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTA
LKFSCLEVGSCLPSTRGTALIPPSLPPTGSLIGQRLSDHPDVRKIGFTGSTEVGKHIMKS
CAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHD
EFVRRVVQEVRKMKVGNPLDRDTDHGPQNHHAHLMKLMEYCQCGVKEGATLVCGGNQIPR
PGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDVDAVLSRANATEFGLASGVFTR
DINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFE
Y
Download sequence
Identical sequences ENSPANP00000009258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]