SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009281 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009281
Domain Number 1 Region: 29-165
Classification Level Classification E-value
Superfamily dUTPase-like 4.71e-49
Family dUTPase-like 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009281   Gene: ENSPANG00000013746   Transcript: ENSPANT00000029170
Sequence length 170
Comment pep:novel chromosome:PapAnu2.0:12:36760651:36761163:1 gene:ENSPANG00000013746 transcript:ENSPANT00000029170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSGFAMPCSEETPAISPSKRPRPAEEGGMQLRFARLSEHATAPTRGSAWAAGYDLYSAY
DYTIPPMEKALVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVINEDYRGNVGVVLF
NFGKEKFQVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
Download sequence
Identical sequences ENSPANP00000009281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]