SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009305 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009305
Domain Number 1 Region: 171-646
Classification Level Classification E-value
Superfamily ALDH-like 9.95e-136
Family ALDH-like 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009305   Gene: ENSPANG00000012208   Transcript: ENSPANT00000015117
Sequence length 658
Comment pep:known_by_projection chromosome:PapAnu2.0:6:120346218:120397865:-1 gene:ENSPANG00000012208 transcript:ENSPANT00000015117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIHHDHQVTSCILQFQNPCYSLLYFSANILLKRIPSWSRGSRSLSPDGSSPLLPMALPL
FQSGFSRRHLRKTRGRGGGGGVVPCGRDRVCPMGSLGRGAGLYFSNSTGLRLLPNSELSM
WRLPRALCVHAAKTSKLPGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWGG
RGEVITTYCPANNEPIARVRQASVADYEETVKKAKEAWKIWADIPAPKRGEIVRQIGDAL
REKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHALIEQ
WNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDN
KLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGNN
AIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFVHESIHDEVVNRLKKAYAQIRVGN
PWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHDA
SIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIV
NVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKHYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences A0A096N9I6
ENSPANP00000009305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]